PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g25910.4
Common NameLR48_Vigan02g004300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 73aa    MW: 8217.43 Da    PI: 10.8154
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g25910.4genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.8e-121371248
                     HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     l+ +v+++G+g+W+t+ +  g+ R++k+c++rw ++l
   Vang06g25910.4  1 LAAYVREHGSGNWNTVQQNTGLLRCGKSCRLRWTNHL 37
                     6899*****************99***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-14140IPR009057Homeodomain-like
CDDcd001678.23E-6137No hitNo description
SuperFamilySSF466895.01E-18167IPR009057Homeodomain-like
PfamPF002493.2E-10137IPR001005SANT/Myb domain
PROSITE profilePS5129415.56141IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-114171IPR009057Homeodomain-like
PROSITE profilePS512949.0484272IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
LAAYVREHGS GNWNTVQQNT GLLRCGKSCR LRWTNHLRPD LRRGAFSIEE QNKVIGLHAL  60
MGNKWAKMAQ EV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-119AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141541.16e-41hypothetical protein PHAVU_008G205000g
SwissprotA2WW876e-33GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC26e-33GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A0L9TTG73e-46A0A0L9TTG7_PHAAN; Uncharacterized protein
STRINGPOPTR_0009s02380.15e-33(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.17e-36myb domain protein 81
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]